PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC02G07060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 135aa    MW: 14814.5 Da    PI: 10.922
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC02G07060.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_147.73.5e-1554115162
                      XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                      +ke kr +r+ +NR++A+  R+RKka++  Le kvk Le++N++L ++ ++l++e + l++ 
  OPUNC02G07060.1  54 DKEHKRLKRLLRNRVSAQQARERKKAYLNDLEAKVKDLEKKNSELEERFSTLQNENQMLRQI 115
                      5899*****************************************************99886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.0E-1554118IPR004827Basic-leucine zipper domain
PfamPF001709.7E-1455116IPR004827Basic-leucine zipper domain
PROSITE profilePS5021712.59956119IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.31E-1458116No hitNo description
Gene3DG3DSA:1.20.5.1701.8E-1758118No hitNo description
CDDcd147041.77E-1659110No hitNo description
PROSITE patternPS0003606176IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009737Biological Processresponse to abscisic acid
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0010017Biological Processred or far-red light signaling pathway
GO:0010099Biological Processregulation of photomorphogenesis
GO:0010114Biological Processresponse to red light
GO:0010218Biological Processresponse to far red light
GO:0010224Biological Processresponse to UV-B
GO:0031539Biological Processpositive regulation of anthocyanin metabolic process
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0003690Molecular Functiondouble-stranded DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 135 aa     Download sequence    Send to blast
MESDEEIGRV PELGLEPGGA STSGRAAGGG VGPERAQSSM AQASARRRGR SPADKEHKRL  60
KRLLRNRVSA QQARERKKAY LNDLEAKVKD LEKKNSELEE RFSTLQNENQ MLRQILKNTT  120
VSRRGPGSSA SGEGQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2oqq_A1e-1579118342Transcription factor HY5
2oqq_B1e-1579118342Transcription factor HY5
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00117ampDAPTransfer from AT5G11260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8337681e-143CT833768.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSA034A06, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004951525.11e-77PREDICTED: transcription factor HY5-like
SwissprotO246463e-54HY5_ARATH; Transcription factor HY5
TrEMBLA0A0E0JX201e-91A0A0E0JX20_ORYPU; Uncharacterized protein
STRINGORGLA02G0074000.18e-76(Oryza glaberrima)
STRINGSi018524m3e-77(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP140838111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11260.15e-37bZIP family protein